TCDB is operated by the Saier Lab Bioinformatics Group
>gi|491597431|ref|WP_005454993.1| hypothetical protein [Saccharomonospora cyanea]
MFDGVARWWDGFELWLAQQWFPIQFVLVIAVLLPLCAVAAWVVHRGVDGVADRLAALRRAGAPADDTERGEGRGRSDAVS