TCDB is operated by the Saier Lab Bioinformatics Group
>gi|516655498|ref|WP_018024487.1| hypothetical protein [Corynebacterium ulceribovis]
MSSIMERWDAVEQWLIAAPIWLQSVVLLIVLIPLLTVVAFILIRIIDIAVGMAHSRWAQPGFVVEAEHAEHKEQKES