TCDB is operated by the Saier Lab Bioinformatics Group
>gi|590561697|ref|XP_007008883.1| PLAC8 family protein [Theobroma cacao]
MAPGLNSLGLTTLILSSARNASMHRNNCEQLAEHVKLIGNLLEKLKSTNLVTLPAVKEPLDGLDEALKKALDLVESCRDK
SWLYMLALGWSIVYQFRRVQAETDRYLHLVPLISLVHEFQMQNLEECLQAIEQDQREYSLDEEDVEAQRVILKPDRTKKD
ANILEKSLSRRYPDLRFQEALQEEKEKMHVELQRSRTIDDSKQCRVIEHLIDVTENVVNVLPGKEVHKLLVNEPAYVLAG
YMTNEKPRGRELGLKTEERCQSEWQVDLFDCCSEPCLSLKTCFYPCGVFSSITNVVSKGKTSREQAISDLMAYSLICGCR
CYSCCIRKKLRELFNIKGGSGDDYLTHLICCCCAMVQEWRELEARGFEGCEGREMIPPPYQYMKP