TCDB is operated by the Saier Lab Bioinformatics Group
>gi|652404844|ref|WP_026800615.1| hypothetical protein [Pontibacillus halophilus]
MDILAVYLILASVTPLFLWKSYPKSALGHIPFIGAMWAYYIIVYTSVSAPPFLSGLLLTMFIISLVYAHVGIYMVLIHDP
FVRKRLRSNPDIYENRYH