TCDB is operated by the Saier Lab Bioinformatics Group
>gi|815932203|gb|AKE50508.1| sid-1-like protein A, partial [Leptinotarsa decemlineata]
VNLGHKYSLLVSPSEPRYVFYKFNENTSDTIVIEVDSEDDVCLIVSVQDSRCPVMDMNKDIKYEGTYQTVNLKGAITVPK
RNFNEGFFLVFVARPDNFDCSEESSLLPRIMSTPVTDMKTTSNVTFTVRNGINVKQYRIGVFATLGTLVAVGLLCIILNI
AFNRFGTISKTDRKTETDAPDGFPAFRRSEQIARLL