TCDB is operated by the Saier Lab Bioinformatics Group
>gi|815932205|gb|AKE50509.1| sid-1-like protein C, partial [Leptinotarsa decemlineata]
ASDETVEFIINVHYQEKFYIDHSEEYNFTVSPSEPKYFFYNFSTNVSQLMIAESNYETVILEVSSDDDICMTVSIQNISC
PVFDTNQDVTFRGFYETVNKKGGITIPKYKFPYGFYVVFVVKPDDYQCTRTIGLLDMNSTRKKHISFIIKPSITYGDYLK
AVIITLSCIGAFYVIFGLSYFLCSVRGNLPRQMSYVPNNLP