TCDB is operated by the Saier Lab Bioinformatics Group
>gi|831764108|ref|XP_012751077.1| hypothetical protein SAMD00019534_092090 [Acytostelium subglobosum LB1]
MATILLSGGQYKGSKNKNLKIDFDIQISVLDTTLPVINCEGVGQAFNIERGATVTFNGFSIVNCSASLGAAMSISSSTVF
MEDFSISSSKSDMGAIFANNSMLYISSSSFQNNTALDDGGALFLSSSSGEIKKSLFVGNKRVFAKTTVPSNIFAFDRSIV
LVDFAKMNNFTFSSTCSNSSISNQLGQSFCDSVVSSSIPSAIGNASCIKDGVCNPLNENFFSCPSDCPSTSFSGFLQTDY
LCLYNRSNSNWYNCSLFQNAPQSLPTFHVMDNVDGPLLGNLTGYFNMPFDGPITLLINISNLNLNVSINRRQCITYQFDP
TIRYKQLECRQYLVRDQINQLVIDYSSNSKFTNPRKVSIVYKLGDRNDFKPLDIIKFSRNVCGDNIFDKEEDCEVDKVSG
FGHRDHLFMNSTSKCGDGICNEENPNQCLVDCSRYITERCPALNIEKGRLVPFSVRSDTLGKMLSNRMIWGLPGYQHMSF
AINIVNGVQAGYPILQLSFCNDKESSYIEDVFRNAVYQVPKEISAVPQPRCTFSVTNKIWSSSSEMSSEMSKSTAYSIGA
NANGNFDSVGVQASVAFSREQSTSTASKLSFQKSGSLIDTSVICSSSSVQLTEFVFHPHFLEDLANAESDQDFDLLLIKY
GTHIYHTAILGGQLKQITFTSKSTHSADEKSETTQQTSMAFSTAVTSPVLNVHGDYSSNTNSATSSDSMNSFAKSSSRSQ
IISKGGAPGSFGPSASSAPTTFGEWASSVDMLPVPVNYTLIPIRGILNPLWRTRNEANLTEMWTSAETRMYKYVQDNPES
LSTGYSDNVYNATFFWVLGIPLSPVTIQSVYNSTIRSRVNTAAILGFDYNSLIDKIDFIDGTLVQTVFQANLDPRVFNIT
FLLQDRSKFNMITRRNQISNAQGNVFEIKNKIFLKSQTTIKLPGNYIWENNSISTNPIDIPIFDSYDFDKEGNLVAEDNT
KGRMAYLYVPPMAMDYKYLAINIHIGGYVRVVYINNINVPQGKWRLFEVPSSVAAMILVATAIDYSPNYDWIAGRDGAVN
WYTSGFSEPGVPEYPGHWFMHNDDSKKHVTDLGVPDGWPYMAVTTKYIHGDDDRRYNELGNPSWDVDVSKIKIYGTNAIF
QPIPYNSYFFLGNGQSQYIVLRIGDSKQLFTGSGMNDHPLDQFSVGRLSTVDTIRHINRIDNDDWWKAVVNQLPSPSFIP
PNMDDIVSSLPDADDY