TCDB is operated by the Saier Lab Bioinformatics Group
>gi|938887652|ref|WP_054672879.1| hypothetical protein [Calditerricola satsumensis]
MVRQNRLDQWFAYEWLSDNLFSILLIGLSVVLAIAVWMVVRRSDGWYTRRAALRRRRDGEDET