TCDB is operated by the Saier Lab Bioinformatics Group
>gi|950989829|ref|XP_014504225.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Vigna radiata var. radiata]
MEDLAQVLGLSATRVASAVISAAHNASAHRRNCERLVEQVRMIGNLLATLESTEVARLPATKEPLDGLQEALREALELVE
SCKDKSYLYMLAMGWSVVNQFRHVQTQIDRHLQLVPLISAVHDFRMQHLGQEDQTEYTLDEEEMETQNVILKTN