TCDB is operated by the Saier Lab Bioinformatics Group
>gi|982167516|ref|WP_060331514.1| autotransporter outer membrane beta-barrel domain-containing protein [Burkholderia cepacia]
MGAGGSLAATGAVNLANAGATLDLSAATSAQAIGALAGSAGTSVNLGGNSLTLNGTTNATYAGSIGGAGGITLSGSGTQT
LTGTNVYSGGTNLNGGNLAVGSNTALGIGAVNVNGSSSLDATANVSLANNVNVATGTTLTLVGSADVGLSGTVSGGGGLV
KNGAATVTLSGANNYAGGTTLNAGGLVLGNNSALGTGALTVGGAATLDTSANLSVNNAVNLATSSTLTLGGSHALTLSGG
ISGAGALVKDGAATTTLTGTNTYTGGTTINAGTLAVGAGGSLAATGAVNLATAGAALDLSAATSAQTIGGLSGVAGTNVN
MGGNGLTLGGTASGTFGGAIGGTGSLTLAGTGTQTLNGASTYSGGTNLNGGSSVVLGNNAALGTGTLNVGGAATLDTNTN
LSVDNAVNLGNGSTLTLGGSNALTLSGGIAGAGGIVKNGAATTTLTGANTYTGGTTINAGTLAVGAGGSLAATGAVNLAN
AGAALDLSAATSAQTIGGLSGVAGTNVNMGGNGLTLGGTASGTFSGAIGGTGSLTLAGTGTQTLNGASTYSGGTNLNGGS
SVVLGNNSALGTGTLNVGGAATLDTNTSLSVDNAVNLGNGSTLTLGGSNALTLTGGIAGAGGLVKDGAATTTLTAANTYT
GGTTINAGTLALGAGGSLAATGAVNVAGAGAALDLSAATGAQTIGALSGVAGSAVNLGTNGLTLSGTASGNFGGTIGGTG
GLTVAGTGTQTLSGTNTYTGGTTINGGSTLALGAGGSLASTGTVDLAGAGATFNLSGASGSQTIGALTGAANTNVDLGAN
GLTLSGNGNHAFGGTIGGTGSVTFAGAGTQTLTGANTYTGGTTINGGSTLALGANGSLASSGAVNLAGAGATFNLSGASG
PQTIGALNGAANTNVDLGANGLTLSGTASGTFGGTIGGTGSVTYAGTGTQTLTGANTYTGGTTINAGSTLALGANGSLAS
GGAVNLAGAGATFNLSGASGAQTIGALNGAANTNVDLGANGLTLSGTASGTFGGTIGGTGGVTYAGTGTQTLTGANTYTG
GTTINAGSTLALGANGSLASGGAVNLAGAGATFNLSGASSPQTIGALNGAANTNVDLGANGLTLSGTASGTFGGTIGGTG
GVTYAGTGTQTLTGANTYTGGTTINAGSTLALGANGSLASGGAVNLAGAGATFNLSGASGSQTIGALNGAANTNVDLGAN
GLTLSGTASGTFGGVIGGTGGVTFAGTGTQTLTGANTYTGGTTINAGSTLALGANGSLASGSAVSLAGTGATLNLGGASG
AQTLGVLTGGTGTNVNLGANTLTLNGSGNNTFGGAIGGTGSVTFAGAGTQTLTGANTYTGGTTINGGSTLALGAGGSLAS
GSAVNLAGTGATFDVSGASGAQTFGALSGAVGTNVNLGGNALTLNGSGGTFGGTIGGTGSVTFAGAGTQTLTGANTYTGG
TTINGGSTLALGAGGSLASGSAVNLAGTGATLNLGGATGAQTLGVLTGGTGTNVNLGANGLTLNGSGNNTFGGAIGGTGN
VTFAGAGTQTLTGANTYTGGTTVNGGSTLALGAGGSLASAGAVNLAGTGATFDVSAATGAQTIGALTGTGGTNVNLGTNA
LTLNGSGNNTFGGTIGGTGGVTVAGSGTQTLTGANTYTGGTTINGGSTLALGAGGSLASAGAVNLAGTGATLDVSAATGA
QTIGTLNGATGATINLGANALTLNGSGNGTFGGTIGGAGGVTIAGTGVQTLTGANTYTGGTTIAAGGALQLGNGGTSGSI
AGNVVDNGALIVNQSGNVTIASVLSGAGSLTQAGSGQLTLTGTSTLSGPTTVSAGTLAVNGSLGQSTVTVQNGATVTGTG
TIGGLVVQGGATAAASQPGAALNVGGNVTFQPGSTFQVAASPQQSGSLAAGGTATLNGGTVQVLANQSGYQPSTTYTIVT
AASGVQGAFSQVNANYAFLMPTLSYDPNHVYLRLVQNGTSLPDVATTPNQRAVAAALGGLGAGNPLYDAVLTTDVPTARR
AYGLLDGELQASLKSMLLLDSRYVRDAVTDRVRQGLAPGSGPLAALSSGGAALCGDNTAGAVDPTLPPERRIGSREGCYG
GTPYQPVVWGQAFGGRSRLTGDGNASTINRSMTGFIAGADMALNDKWRAGLAAGVTHSSLDNAQSSSASVNSYYLSLYGG
AQYGALGVRGGASYTWYRINSDRNPGFAGFSDHDSAGYDANSAQVFGEVGYALPVGPVAIEPFAGLAYVNLHTDGYTETG
GAAALRAGGETTHVGFSTLGLRAASQLGSIGSGTFTARGTVGWRHAFGNVRPSSAFTFANGGTSFQVSGVPIARDSAVLE
AGIDANITKRLTLGLTYSGQYGSGVRDNAILGNILWKF