TCDB is operated by the Saier Lab Bioinformatics Group
>A0CS82|A0CS82_PARTE Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia.
MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYIVTYIYCVYQLQLLIDYFTPL
GLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFRPLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFL
FCYFFVIVGMSIRKYIKHMKKYGYTILDFTKKK