TCDB is operated by the Saier Lab Bioinformatics Group
>A0D5K0|A0D5K0_PARTE Chromosome undetermined scaffold_39, whole genome shotgun sequence - Paramecium tetraurelia.
MINKAGKQLTWLFALKILSRIFDLSLNILVLRDLEPGIYGLTTNLDLLTNITLFYLKIVLKQTYSRLKDPNQEQTQSAVN
LMYFGLLITICIAPITVLVMSYNQSVAFAKTAFLYGISAVIDGASEPYAVQWIIQLKLNVVAKAEGLAVFMKTIVLYILL
GKYTRELFQIETVIGFGIAQVIYSIFIFGYIFSLSNQSKFKQLNKEGVYVVAEMKQVGYQFTLMAFMKFLLQELEKIVMV
IYNNPIISGEFTLVSHIGSIIPRFIYVNIEQIAFNLFPKINQEEQTQLLQKYLKFLNLVGISIVSAGIPCASAFLQIYGS
QWTSDSCILAMQLYCIYIWIMGINGITESYVNSTIDTKDMWWYRYLLIAQTIIYSLSLVILVQMGSSGIIISNILSMSVR
IFVSFLIINKQGIKIQWNAIMPKFMILYLLGFLFQYLTEGFQLLVLTALYYGILGLINIKTVTEVIKSN