TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0DG78|A0DG78_PARTE Chromosome undetermined scaffold_5, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00002174001 PE=4 SV=1
MGYFEVQPTFQDVNENESSNGQPMKVILLLVDALRVDLFANRNFTFYEDMKENQEDYQILYYGISSTPTATQLNLKSITT
GNFPAFVDFGSNMAAQELKEDNIIYSMKRNNKKIALLGDDTWYHMFPKSFDYKFVSESFDVRDIDSDDNIIINNIEDLIT
ENQYDFIVGHLLGIDHSGHSQNDSNKFLWKKQRQYSKLLYKIYKKMDNNTMLFVVGDHGMSPDGNHGGDSFHEVSSTIYG
INKKYKFNKDKFNSVIRNKRYINQQVLDRNLYTRQVFSINLAPTISYLMGISMPFSNMGAILTEMINTNEQQESSCKENL
IQVMTYLNKLVKSQGTLDIQLQKYEDQLSNPKLTCQNIQEIILELQVEIKEKAKTHDYYFLYLGASMMIILFGFHIIKLM
EYLFDKKFSHQNAYIVYRLEFLIIIVPLAIFIYLLFSLYLSIKFIAFYIIFAIMKQLLLPLTQVENLKLIINKVMNPLPH
YRQYFMIFTNIIVQKGIQELSLRRQYVYSSNIFGTLLNIFIIILITHFRLLKQILYVAVGLSLLILAEQYNTPNLTTQAQ
SALIFNEVNYIFQSFWIKFILPAIFLQTILYKLNFKIYFYIFLGLAQFVYLFNNCQAFNKPLTDIFEGHLKILTIYLPMF
LYICSIVMIVIFRDFSYFFLIILTVSGKQGMMVYCCLFNSIYYLTKFYLKIDRAWLPLIAGATIQLILNYSWFCLGHRMS
FSNVKFQDALIGSENFNVLFNMTLLIISIVRLMKQFQFGIFATLDIIKKITLQVLKNDQNIDYKFAVYYFNNKIIDSLIV
MQFSQIAFSALHSLRNLYHLRVVELFAEKLVYESIFFIVMILVRSLGILLEKFDPQQKNELYFQQYQTITNDLKDQNNE