TCDB is operated by the Saier Lab Bioinformatics Group
>A0E9B5|A0E9B5_PARTE Chromosome undetermined scaffold_84, whole genome shotgun sequence - Paramecium tetraurelia.
MPESQLGSVRMRPSQIQIEDDQQASTRRRNFLSPTFSQNLPLFRELQSRQAQNREQDYTNSIITLTDDKVISCHAQMIKS
LMFNLFLQAFFVNYFTYMHWKYSHRYVLLQLWIQDLITIFILIYYNYRKGDDCIWQLIETMFLFFFKVCINVYQIFIVFY
YEVQEFKIYFITIMMLAVSSLLLIMKLVQKIKTPTKTSTALILQFLKTMCCLQLLLITLKWESKISWSWIQIFLLLWVFL
VVCALLLFISFVSCIETLVNIIKKKQQCHYCIYLKYSLVAGNLWIFIMLIGFTLFPFLFILRTAEFYEGNQLISLTETAK
YIVVITLFSLFLLIFTLCFYRQIKAYLKDVQGIQDQNDIDQQQTVQSPNSRQLNSPHQSKKLEFIKLGIPLYLIKLSCTY
FAVLDKPSFDFKKRQKSHQELESGRSNLQGSTVRETWKKILQKPAASNSMIINKKKDELDLDIQKPAITDNVKIKREEIT
ATVSKQEQEEEPVRSIKSIKSDGESSVNQDKCLVCYENIPNIVFVPCRHGGICQQCAEDVIQKSNECYLCRKTISQILKV
QKNGNKQLEVQEASMLG