TCDB is operated by the Saier Lab Bioinformatics Group
>A0ECD9|A0ECD9_PARTE Chromosome undetermined scaffold_89, whole genome shotgun sequence - Paramecium tetraurelia.
MAQPNEDQPSLAELQSTQPQRLIRLFFKYILSDIAKRPRSFKIGLLSTYIVIAFLGLLQCLKSLSPFLFLQLAETSVGDT
DLQFLPKTLASKNDFRLINITELRQYTSQIDEFLDVSPRWLFMCDIYNPKASLNLTSFFMILDSQLENSIGLGRRLDTDI
ITSNQIYISNTLQKGLGVQIGDTIQIKFSVLQFLKHFGFNNTEGESKNHLRESFKRFLNDLLQISDDDILHRKFDVATML
KYVEEYKYFVNDLEASEWKKNQTKKSLIQSIYSQNITTPQKKLAKQMVDYIFTRNLTKDARSMYRFVFRLSKFTKEITIS
QIEDGFFDIAIEIAEFELNFSVYQSVESPKGKWTEALGMMVFMDYKDATSLFLDAILDRFDAVIKQKRKYDQGMAGAVSQ
LIPVKETRNSVRDKLKHFQLQEYSLMANVVFQNKYPKYETPENAKAAVISSTNQFYSIAGYDYPVQIMAPLGFIVELYHL
IKHFIDTLIQVATIILLMLSILLIYSLMIGDVDEKTYEFGMLRALGFRKSWLIVLLLFQALTFAIPGLLLALITCYLLNA
LVSMYIFDMSLLISSYSIPLYALIVQISIGICMPIVSNILPIKQALSTTLRDSLNLLHKVVSNIVVTVMRLEKIGISLNQ
TIYSIMLISIGFISYYVIPMNIIYQNVGLAIFVLNIVFVTMLIGVTMIINLVQKIVEKYLLYLILCLKSSDQNLKPVILN
NLKSHENRNAKTTLMYSLGLSLIIFTGSSFAIMSQMMQNYIKVSTAADIRIFDASKKFGLDEYGLRQHLEWEQKNDSTLI
KDYTFSALPLNEYPGIQNHFSISPLSRFPRNLIILQPVEKNLLNSITLEYYQPTEYDTESSDVKYLDNGVRDGIYDLYNR
DSNYDMKQQKDISGIISNSKYYQIFEPKQKTIKIDREINIIIPEGYRNAGSISVNTPALLTIKNKEYMIEKRLKIRHMAT
KIPNFDFSAYTTVVFFGQGLITMQDAELLLKEILNNRAVRKSRKYRKLKEFIEQLPKNLSFGLPKDQLFIKFNRDTTREE
RLDFSNRMRNYFKNDQIYLIDSQELMRTFDEVFTYFEIFNAVVAAIALILSFFLLLISFISNVRNNCWEIGILRAIGLQE
VQIQKVFIYESISLIVSSGLIGSLVGFITASTFAMQIATFSESQFRLAFPLYTFLFTFLGGILIAVASSYLAVRQLKNKE
IAFILKNQI