TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0EF36|A0EF36_PARTE Chromosome undetermined scaffold_92, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00026250001 PE=4 SV=1
MVPFIVLLPFVDKQERKQRVIVSWYKVSYLSIINWIFYCIFTYYLGYKFFSEEILKQFKLIMKCHLIISLTISVYFVIGL
FLSLLNSEIQLVMIERLNFNSEIYIFGYESVFALMLCQLLLYLAMVVFLLFIYWNAQMPQYEYVEQNENYTFQQRKTSYL
RQQSIMDKIIMLIIVQLCLNDGLITLFLVLCMLVWLAIHFHILNKRSRFRYCQIVIKSIIVCSFVALLMLILSGQQNYSF
STLNGTLNIYRIFRIFGILIMTTILILSMRAYHYQMIIGDEEEIEDLEKEIQKDMRLKISSLEILLGENYFGVIMILSVF
WISKQFSILRGLVYLILLVGQLKRKHYKATRRWQCAIAILYLAFVQFFLLKFAYFQYLGVYEQPQFNPNELFAIWNYFYN
RFNIIMIDLFYILIVSWLVYSQQTIDDRRRQKKINDLDSKDRPNREQKQSCWSNFKSNLSSFSYQIQKSFLIHFDEIVII
YSLITALSHADIFRGVFLIFFILYAFAQLEKRRKFMRNHLSIGYIILFILYSMQLMFLGSLQTLNFIFKFGGLDEVTQQF
KFSFYFIYKYYDIIIGCVLLTFQIQVIQKSDHYQEYKKKLNDYNLDYLRQILQTNGLIFCQIIALIVAFIPPANLLSLIF
IFFFQLFLYLYYIHGQLNIIMDRLYQYWPLMITLTLIILIVRYTYTIKFFYYFVELYFQQPTLLSDFGLDPNFNTLKLAG
TGIALLVLCAYKRAYLAPLIEQQKQQKQIYKKGTLAYYIYCIHIKLCVYSVYHIQKVTFMFSFFISVYQQSYIGFLFGIM
IFLIMLNEMNNNWQNTSIPFLVIIFVQILIQYIFQAELLRNAQGQETISWIGIENQYQNKYWYLLIMFHLSEMLQVLNVM
FKQQVNDYLQLFLISTDREISNLNLLQQLLHSLQENIIQEQNSVESDASQQQQIELQARDENSQESIFYDELDEQNERFA
KIQSYYILKSSMQQEQFYYRVYPFYRALKFHQSVDNLFTQIGLEVCLFFIVITAYYQRNFFSVFYIVVASAFANKSHLLD
RHQKLGIFGQAWGALCILQMLEVIRKYATLQWTPPSWDVRKPWWYFSYSCDPRGKESFNNDDPDDSTSDFMKCQTDWNYW
LSLQGYTNWDLWINFIALLISLCYYRHFKTVQRRQQEQEIQDHLHPEVEQIQANVMDKNDFTYEENRTKITDFIKFFIFC
YFYKFALIIFLLIGMSSDIQSYTEVISCIYFFLAINLLYMSEKLEKDRNIIWGKLILFNTIVMIAMSLYQAPFIKCPIIY
ENDRYYYDNVECVQIQLNNHYYNSDFFIFLQDEFQLLAKQTNDVFKKYEGVSTLDVIYMFLSHLLGLNKTLDFRFGFCKE
TLMAFFFLLGLLQRNIWAHPYMKQYVDPYLNRRQVQLQLVEGIHLKRIWDFKYVQAQKQVHESLQQRVQNRVEKWDNFFQ
FDDNKSLKKKSFFYLTPRREEQFQIIQFTEERSEDNQQHTSFDSEKFQGFKGEPKKLIKAERITQQNKAPVIHLYDACCI
VKNSINKKDLRLRLKKLMLLEEKRQLEKVYLNDRIGLTNYHVGVIDEIDRKIIQVDNEIAQLFKVQQLRKSISMRDIKMI
PFEEYKEDRKSFEMLSERDERLQQISEEESAKDFKKPEEEQSDDENSIVQPQKSFSEKLKDLIIYILTHDTYIREQEQQQ
NEIDKKKLSVLIFVFVAHYFQVVCVLLMVVNACFNANIIALFYPFSAFLYGLLENPVPSRRYWNFLLIYTIIIISLKFIY
QMPIFCDSPPYRFIGFSQEEACEPRVTTQQEKITRIDYVIGIRKYQGAETFMNAIWIELLLFIAFLIQRYLLQSQGIWDY
MKLSLDQYFIPQFQQQVEDQLSEHKQESSSKESEQESDDFSENHQVQEQQKEQQTVMISIQDTCTSVWQQIVKYYYRLFP
HALSTIYIQRKYDPATKQMIIKDGVVLPEQIKVGRDFYAPGFIICLIILVYFLLFYPNIIAKRSYAHITQGQSQRFSSEV
IFVLLVVIAIIITDRALFIMRKVTKDPRNDKQNQSGNDIQKYTLMIKVAIHFILIIVVHYYFFFVIPQKTNKRFQESYYL
IFAYILVCIYFMISSVQIRYGYPIQKYTQIFTNSHKPANSMAFKIYRMIPFLYELRVIIDWTFTTTALDLIQWFRLEDIF
ANLYICQAYQDSRIENHKLGDPRSSSDKCLNGCLYSMFIVFIIILPILIFSTLNPAVEINNITNGKFSIKAAFFGSDDKL
FFTLFQVNDLELLDIPNEQFKKIQKIYGEIETSWQERMQKVRIKRFSDLEWNLPENYRDQIRNMIKSQQYQVEIQCEWVF
QKSDSQGGAKSFTGQSIVQAPDTFVNNFGKILAPRAPDAVFDIRELVPKFLYVGESAETQALRLEPVNIREEISYYQDIR
LIHKKTSDFVFFELVPNDDSTDLKQIGASSQNRVEFFVLNELAFGSLIGALSTNMSIISIYATFVLTIGRFLRFAYDKIS
TRVMFEEMPETYELFDLCQSIYIARVDGDFIKEEIFYELLIRIYRSPEILFKMTGASIYDRQKK