TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0L5S6|A0L5S6_MAGSM Ion transport protein OS=Magnetococcus sp. (strain MC-1) GN=Mmc1_0798 PE=4 SV=1
MSRKIRDLIESKRFQNVITAIIVLNGAVLGLLTDTTLSASSQNLLERVDQLCLTIFIVEISLKIYAYGVRGFFRSGWNLF
DFVIVAIALMPAQGSLSVLRTFRIFRVMRLVSVIPTMRRVVQGMLLALPGVGSVAALLTVVFYIAAVMATNLYGATFPEW
FGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAMAITKEQEEEAKTGHHQEP
ISQTLLHLGDRLDRIEKQLAQNNELLQRQQPQKK