TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0LKC3|A0LKC3_SYNFM Uncharacterized protein OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=Sfum_2193 PE=4 SV=1
MGHRCSVNLNSDVSIMTFPTNGSWTDKLCAGNKIARTVFAAVFLIAAGMVSVAHSVPVSNNVPLDHWSYGALDKVAGFGL
IRSDLHGIRPYTRMEVARLVHEALAVREEKSLKLPPLIEHFLERFQREFREELTVYGRGDSDGAAIMTIKPIEEAQARYA
FVDGKPRDFVNFGKRNGQYPWSPSGIVASEKTPLLYGNEGIVYGEGSNFSLQFSSSAKLWDLFSGYVEPILIVRQNEDPG
RSLDGLSGGREHGSLGAFDRVGFDLHKGYVKFSPWNVEIEFGRDSMCWGQGYAGSLIMGNNAGPLDMLKITNPTNTLLPW
VFRYLGPFKYTVFVARPDDYLNPLNPLLSGGSVNFKPLPWLELGFETAFLMNGEDRPSTSLSNYLKALFGFGFGQPNEID
QVGSFEARLRLPFLWNAELYLEYGGEDSGGEEFFEEWFGFGDVGYLTGIYLPRITPDGKTDFRFEFARTAHRVDSTPGFW
YGHTSYRWGYTNDQMIVGHRIGPDAIDYFARVTRYLRNDLRVGVDFEHMVRGVSLNVVEEESNGFGADVAWDIDSRWSVA
ARYAFQDISNFNLVRGDDQANHLLVTGVKFSF