TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0Q2F5|A0Q2F5_CLONN Sodium:alanine symporter family protein, putative OS=Clostridium novyi (strain NT) GN=NT01CX_0309 PE=4 SV=1
MGGNNIVQILGNIVAFVSKYLWNLFLPLIILASIFVNYKMIKFRGIISKKDKTKWKLSKMKSALSISLSSKIGTGAIIGV
LAAMWKTSNNGVGGESIVLWIFIGMFLLVPLTYSEVLFSQVTRMNPRKFIDKYVGKKAGAMYAICLVILYSFGFVGFQMT
GIQSVINIFSKQNFNYEFTQNGRLLFIVLPILLVVSIIVITKSHKIFINTLGSLVSIIILLYGIFFISFVFSTRSFIPNY
FSEIWKDFINFKSASIGIPIGLIIGLQRIIQISETGLGTSALASSDAENSPRREAFIQMLSTIITTFIAVVITSYVFMYG
RYNLGITLTGDGFHRISGYLSSIITVTGYLGEGIIMIFFILSGLTTVLGSFHFLNITINASENKRILFYLSLITLSGILS
IANFDVIFDASDLLMFIVASINILAMVIFVSKHIDKFNIKTGGIDNE