TCDB is operated by the Saier Lab Bioinformatics Group
>A0QQH3|A0QQH3_MYCS2 Cobalt-zinc-cadmium resistance protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155).
MGAGHDHSHHTDARVSRMLVAAAILTAFFFVELITALMINSIALLADAGHMLTDLVAMFMGLTAVLLARRGSTSPARTFG
WHRAEVFTAVANAALLIGVAGFILYEAFERLGNAPEVPGVPMIVVALAGLIANAAVVLMLRSHSKDSLAVKGAYMEVVAD
TVGSIGVLIAGIVTVTTGWPYADVVVAVLVALWVLPRAIALARAALRILSESSPAHIDVEKLRSALCAVDGVTDVHDLHV
WTLVPGKDMVTAHLTSDADTARVLDDARAVLTAHGLEHATVQVEPPDAAGDCRCEAE