TCDB is operated by the Saier Lab Bioinformatics Group
>A0XZ57|A0XZ57_9GAMM Putative uncharacterized protein - Alteromonadales bacterium TW-7.
MKMIISNLLSYSVIELINKSIPFILLPILTAFLSVEEYGQLTLYQIILGGGAIVFSLGMTSIISVDFNKNSKYVRAGQLA
DIIKLCVFSFIISLPVIFIVAIYNSNYYLLIILFGSLGTAISNYFLAYMQVSRNIKVYALLSLSLSLLSFTFTLILIIYF
NMGYEGRLYALSTPPVLIAFLFSWYYFYTNKQCMGESNITFKRVIPLFFHQVSNWSRYSIDKLVLFFFLGGTALGTYNVN
FQMAFILSVLVMVINKTFQPYVLKGLSQVKSTSHLLYCQLFLVAIGTLFIMFLILLFGDSLLGEGFKIDTTIIIILCIAF
FFQGCYLCFCNYLYFYEKGAELAKNSTFCFFFTAVSSVPLVTYFGGMGAALSILVSMLILLLGTYRNYKRLKLS