TCDB is operated by the Saier Lab Bioinformatics Group
>A0YL48|A0YL48_9CYAN Putative uncharacterized protein - Lyngbya sp. PCC 8106.
MIKIIDRIKKRKKNKSSTNNLHRFLLKSATGTFGFKVANAFLIYANSLLLARVLGFQEFGSYTYVTAWVNLLVIPAVLGL
EGLLTREVAIYQTQSKWNLSHGLIQWSNRIVLLNSVGLALLTTLIIWGLTLTSNSQQLLVFAIAMISLPFMALSRLRQST
MQALRHIVVGQIPEMLVRPIILITSLGGIAFFLNKNITASGAMGIYLVASITTYLVGEWLLRKHRPKSIKQALPEYQSKY
WIKSALPMLLIGSMYLINNQTDTVMLGILKNSETVGLYTVANRGAGLISFVLIAINTAIAPTFASLYAEGDLKKLQKVVT
NGCRVVFFAALIIATILMVFGQHFLLLFGAEFIQGKTALIILCLGQLINASTGSVALLLLMTGHERDTAIGVTISALLNI
LLNVILIPEWGAEGAATATAASMMVWNIILAVFAYKRLKINSTILAIK