TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1B2F2|A1B2F2_PARDP ABC-3 protein OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=Pden_1596 PE=3 SV=1
MVDGVVAPFMEFAFMQRALAGALLLSLSACPVGVFLMLRRMSLTGDAMSHAILPGAAAGFMLYGLEIVPMTIGGLIAGAI
VALGAGAVARLTVQKEDASMAAFYLVSLAIGVVMVSLRGSSVDLMHVLFGTVLALNDDALWLIGLVASVTLATTVLLWRA
LVAECLDPLFLRSVSRLGGAVHFAFLGLVVLNLVAGFQALGTLLSVGLMILPGAAARFWVNDVLAMCVVSVGIGIVSSLG
GLLLSYHASLPSGPAIILSAGVVYLVSLLAGPRGVLRPALPRRHHRTA