TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1BIL6|A1BIL6_CHLPD Putative uncharacterized protein OS=Chlorobium phaeobacteroides (strain DSM 266) GN=Cpha266_2249 PE=4 SV=1
MITLNLISIKRNQSNSNNFDNIGFILLTGNSKTLKVAWHELVKPEGTVPLATSLNFLTNKFWFKLNKGFGNGAFPKSFDA
ITKAQIVLSTELNESIGVKYEELQTQFKAGKLTEEQAKARIINLRSRVRKPEDIERDDVLSVLDTITEDSLEQFIQEQEH
FKIESAKQVEENIQLRESLELKEQELENKEKEALKLKNEAIQKELENNRKLLSTKKSLLREKDNVKKDLLIKKVTIDKEA
FKSYQIFKLIIGLSLISLYALICFIIWKMDWNIIEAWTYVAGILLSNLFPIFYLLIFEKDINPKRYLTNRKLKIDSKTYE
KFKFDIERLKALEQEIDDLNNEIDELKKASTQHMV