TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1CM58|A1CM58_ASPCL UPF0220 domain protein OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_095780 PE=4 SV=1
MDVSNNRLFRWSKPEWLNNSTVRNAGVYTSGALFSLGLFFLVDAAAFSKSSRNGSEVHVKFVDWIPGICSALGMLVINSI
EKSRLQADSFSYSGSGVAWKARFVLFLGFALLAGGLAGSVTVLVLKYLIKQYPFPTLYFGIANVIANSLVMLSTIVLWVS
QNIEDDYTYNLAL