TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1CWT6|A1CWT6_NEOFI Uncharacterized protein OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_105760 PE=4 SV=1
MRALVSRTPIAAALRSATLGSQCASIQYNSLNILDRLPQPLPSRSFRIRYTGVSTSGRVTQTCRRSFQLSASSRDKRGPQ
SAEPDPLERLEVKKVQQQHENEKDDSGRDTKSGGKVAKAMTKGDTIAGKLLTTPSRLFKLLIPLTTINRKDIEQIAILIH
PQQPLSHLERLIQSEVPPIEDENGQKRPPAVSFIALQLEQDAIRPKRGMYEGTDAEIHRVEGGKDDATVAKRGEDFQEVD
ETFSYLRRPGPGQGDKEQRFIRWSQSTEIGDFIRDAARAKEFIVTIEGAPAGLEQIHVAVPSFDERTYFLRMRLRKISRR
IQGLAEIKHECDALAHRGAQRVALGGFGILAFWWYIVYKLTFETDLGWDTMEPVTYLVSLSTLMGGYLWFLYHNREISYR
SALDFTINARQKKLYQMKGIDLQVWESLIDEANAIRREIKNIAAEYDVDWDERKDEQDDRVTEALKKERRLKNGSQKEER
PKDDRDDD