TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1SPN6|A1SPN6_NOCSJ Uncharacterized protein OS=Nocardioides sp. (strain BAA-499 / JS614) GN=Noca_4274 PE=4 SV=1
MHDLTAAHWIYLIGVITILVTMLTRKNIIVPAVGFTFLTAVVFSHSLPKGLSAVFNASLVAAQELFSIFLIIALVTGMLG
ALQALGADQKMVAPFKPVMRNGHLAFWTLAVVTYMISLFFWPTPAVPLIGAVLIPVAIRAGLRPMAVAFTIAIAGQGMAL
SSDFVIRVAPGLSATAAGGNADVVANRALVLSLIVGGVALAIGYLLEFRKMRQPADVLLEEWERGDVESLAAEEVVIEES
PTIGHGAALVHSPQAAQAHAHVAGGTGDSESALVGATGTAVLTEQAAGDAHGNGGGAGNGASNGARRGTGDAMADRALGG
SGGAAVSCPAWITNTFAVAVPAAYLALIVYLIYGMSTKGTDGGLKGGDAAALVGGIAAITIFLAAFAEGRKTFLERSAEH
VVDGLVFSFKAMGVVLPIAGFFFIGNGDFAGRILGIAANPDGTSAAPAFLFDLVLNAQSHIPQNAFVTAFGILIIGMIAG
LEGSGFSGLPLTGSLSGTLGPVVGVEPETLAAIGQMGNIWSGGGTLVAWSSLIAVAGFARVSVIELARMCFIPVVAGLFL
STIVAVLVFG