TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1VF64|A1VF64_DESVV ATP synthase protein I OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=Dvul_2064 PE=4 SV=1
MLFKNWFKINDQRYMDNLSRASAIGLHMVTGTFVGGIFGYYLDDWLGTRPWLTVALLIVGVAAGFKNVYLDTRKLIRDQE
REDAEKFGPKDR