TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2E1Z7|A2E1Z7_TRIVA Mitochondrial carrier protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_164560 PE=3 SV=1
MSGFVGVIGPKYLIAPLDTIKVSKIIHGSQSNSILWNEILMQGFPRLFHGFACDLIRIPNQTIFRYILFDELRYFMNRSI
ADMISATAASVVSHPVDVIHTLMISNPVKYPTISKTAYKIWQTDGINGFLRGIHPTLIGYIPYRSVMFASEIILHKYPIK
NSPVLDFLVHGTVLTCAQFATYPFDVARKRMIADESVRGMNFVGVIRDTYQTRGFKGLYSGFGTTIARIYAFTYLQHKCT
KLAQEFLYNFNYLLRKHEFEDI