TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2ICZ6|A2ICZ6_CVH22 ORF4a protein OS=Human coronavirus 229E GN=ORF4a PE=4 SV=1
MALGLFTLQLVSAVNQSLSNAKVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILF
VYVPLLYWSQAYIDATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR