TCDB is operated by the Saier Lab Bioinformatics Group
>gnl|TC-DB|A2VCW5 2.A.18.6.8 Sodium-coupled neutral amino acid transporter 5
MAISCAVGMEMQEPKMNGTLSTGAAAGYRQEREGFLPTTHGPAPGRKPVQFLDFEGKTSFGMSVFNLSNAIMGSGILGLA
YAMAHTGVIFFLALLLCIALLSSYSIHLLLTCASVVGIRAYEQLGQRAFGPAGKVVVAIIICLHNVGAMSSYLFIIKSEL
PLVIGTFLHMDPEGDWFLKGNLLIILVSLLIILPLALMKHLGYLGYTSSLSLTCMLFFLISVIYKKFQLGCVVSHNDTVV
ESEPAPLQAFNSSCEAKLFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCCPTQRRMQAVANMSIGAMFIMYGLTATFGY
LTFYSTVKAEMLEMYTQEDLLILCVRLAVLLAVTLTVPVVLFPIRRALQQLLFPSKAFSWPRHVAIALILLILVNILVIC
VPTIRDIFGFIGSTSAPSLIFILPSVFYLRIVPADMEPLFSWPKIQALCFGVLGVLFMAISLGFMFANWATGQSRMSGH