TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3U2L6|A3U2L6_9RHOB BioY family protein OS=Oceanicola batsensis HTCC2597 GN=OB2597_04098 PE=4 SV=1
MSQASTARVLTEAFGPTEGAALRLKQAALVVAGIALLAVCAKIKLPVPGSPVAVGMGTFAVLGIGAAYGAKLGLTTIMGY
MLIGLLGFDIFQSSTAELNGVDYMMGSTGGYLLGYVLATVLLGALAQRGWDRSVLWMALAMLLGNILLYIPGLGWLGMLY
GWDKPILEWGLTPFIIGDLLKLALAALILPAAWKLIGRARG