TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3U6A7|A3U6A7_CROAH Uncharacterized protein OS=Croceibacter atlanticus (strain ATCC BAA-628 / HTCC2559 / KCTC 12090) GN=CA2559_03425 PE=4 SV=1
MFQDIFTAIPLGFFLAFLLGPVFFVLLETAAIKGFRAALSFDIGVILADAIFLLIAYFSTSKLLERIKDDPALFIFGGVI
MTTYGVMAFMKLKKALPQEEQPEIRKLSKSDYIGLAVKGFLLNFINIGVLGFWLGLIIVFGPKMDMQPNRLLVFFGTVLA
TYLVVDVFKMLLAKKLNHKLTPVRIFNFKRIISIIIIIFGVILISQGLFPSELDALKHELEERIPETPLK