TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4HHU9|A4HHU9_LEIBR Uncharacterized protein OS=Leishmania braziliensis GN=LBRM_30_0050 PE=4 SV=1
MDLHNPNLPPITAGILYGLSLILFIDGLVLAQKESSVENHFSFVQCIPAIFSTMGLLLLHLVSPSEVKEGDGRGRVLLFM
SWLSMFGSSVGALAIVFFCYTGKQTRTRAAPGVSLVLYTCLAPVITSLLWWSRRVSDSNEW