TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4XGX1|A4XGX1_CALS8 ABC transporter related protein OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) OX=351627 GN=Csac_0522 PE=4 SV=1
MPEERKGSASSFQPPAFAPGPGPGRHPAHRFTSKSAKPKDLKYTLRRLWGYFSSYKIALLGVFLLITISSFISIVSPLLV
QKAIDRYIIPRKFTGLVNIIFAMIVLYILNSLFAYFQGYSMMKISQKVVFNMRNDMFSKLQRLPIKIFDTRAHGDLMSRL
TNDIDVVNNTINASVTSIFSSVITLVGSVIVMLTISPILTVCTLLVVPLMFVLTNWIANYTKEYFSQNQKLLGKLNGVIE
EDITGQKVIKVFTREEKEINKFIDINRQLTSVGIKAQILSGVIPPLMNMLNNFAFIIVAAVGGYLALKSAVSVGSIASFV
QYARQFVRPLNELANQFNQLQSAFAAAERVFEIMDEEEEKEDEKDAIELTNIKGEVEFRNVWFSYKEGEPVLKDVSFHAK
PGQMIALVGPTGAGKTTIVNLLTRFYDIDRGEILIDGINIRKIKRESLRKSLGIVLQDTYLFSEPVMENIRYGKLTAKDD
EVIKAAKIANAHEFIKHLPHGYKTVLTDGGADLSQGQRQLLALARTILSDPAILILDEATSNIDTRTEKHVEEAMLKLMQ
GRTSFVIAHRLSTIRNADLILVINNGQVVEQGTHEELLQKRGFYYNLYMSQFAVV