TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4XHF2|A4XHF2_CALS8 Ethanolamine utilization like protein OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=Csac_0718 PE=4 SV=1
MLINKVLFYLFSTSFALGLLDKIIGDKFKLASKAEEGFVIMAKAIFSMTGILYLYPFLSFILINPSRFLARLFQSDGAVL
ISCILPIDMGGYHISSEVSKDETSKLIGGILLSSTLGASIGFTYPVAFGILKKEYRDEFIRGSLIGIICIPAGILLTSIF
YGFDVLKVFRLIFFVIAIVIILAFGIAKEWFILINLMKILGRAMNILNLIGLIFLGFHILTGRAILPYKTALDESIKLPL
KMAILIAGSYVFFSIVYNVLIKYSGFVRKYLTLNQQGIEGMMILLINCVPTLYLYEKMDSKSRIINAALSITTASVVGPQ
LGFLGAVAPSYISIFLFNKLISGLLAIGGTVLYLRYKSKQLYKI