TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5GWU2|A5GWU2_SYNR3 Uncharacterized conserved secreted protein OS=Synechococcus sp. (strain RCC307) GN=SynRCC307_2448 PE=4 SV=1
MSRTYILFTGLIGWSSLYVPAKAWTQLLNSHDQTKPKQQIEVNNGSAAEQDKPLISEVQLPAEGKAITIGDPLAHQTWKC
DVFMLPRSHACIGPLGIHQPRNLFEHIIQKGANYAALYGPSMVNSNGVDLGGLIQTELSRTLISSGVSYANKQIKKIPFF
AQTTLGLDAATSSDLTGYLDSFMRLKTIGYDNEGDPMGLMFGQARVTLETSAQPQVNVGLGSRFRLGDEAIVGLNGFWDL
RTTNYSTAYTRWGIGAEGFWKSFELRNNWYINGSADKNITINNIDYVERVVPGWDVEVGYRIPSYPQLAIFVRGFNWDYQ
DHSDNSGIEGSVNWQATPHANLELWVSNEIPAYPTDSNDTIGNQPGPYIGARVRLTGRPVVFTKSNTKQNLLTQMTQPVR
RRYEVLLERVKEPTKGENGSITSIAQGI