TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5I0E4|A5I0E4_CLOBH Probable transport protein OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=CBO0951 PE=3 SV=1
MKTKRLVIMGLFIALSFVGANIKIMGSIAFDSMPAFLGTLILGPIMGAIIGAVAHFLSALTSGFPLSLPVHMIVMVDMAV
TMILFGIVYNKFKNKNNILAAIVATVVAVIINGPVSVFAIIPIAGKGVLALLPILSLAALANVIIAIIIYRFIPEKYFQR
DK