TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5N119|A5N119_CLOK5 Uncharacterized protein OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=CKL_2803 PE=4 SV=1
MKEIVLKDGNVLKVDLAPGELLPADNNPFLMSRSEFLAVQAYVENGTSLPKSAEEMTSKLKISAEDVNEFSDLINVYKSI
YDHCYNFKTVVFPMTVTLAANISHYNTKVPVYYGALNPIIAAYNNGSLSEEDATKKLTAILTNLQNTAQVYADDCKTAKE
NIIQFAEDTKSDKSLLDPLSDRYKKAYEGKGGEIDTLLKEIDNDSKQIKKWQDEYEHDVTVAATTPTYAWIIPLGTIAAG
IVAGIYGKKATDALDDIHKYQKKLESAQEDLRKALVLSNDLRLANGSMDGILEKLQLALPVIEKMEGIWGSLSDDFNNIL
SVIQRDIKEAEWIIKDLGVQEAIDAWAKAAAIADNYRANAYITVTTEDDIKAEPEKYIIPETA