TCDB is operated by the Saier Lab Bioinformatics Group
>A6DUG7|A6DUG7_9BACT Putative uncharacterized protein - Lentisphaera araneosa HTCC2155.
MSHFKEKIFKFINSQIIIIAVIAGTLPALAFPETSETWRLAGVTPWLIAGVFLCQGLGLNPKDKIDLSHNLKIISFSMLA
SFLIFPLLAFGVLELANLSQDNYFGLMLICCMPCTLVSGIVISDLAGGDRPAALFITIALNCSAVIISPLLIALYLSSTA
EIDTLSLIKKLALTVFIPALCGWGIRKQLKTTKNNFNLSIKYLPVLFLGTVIFVNTGGQKDEILNGSLNEALYIAVLSAI
IHLCALFLFNFFGKRTSMSDAQNRSFSICCSQKTLPLAIAIWSAHFAQDFPTALIATMIYHLIQIYLDSFIAQKWAQKKL
SS