TCDB is operated by the Saier Lab Bioinformatics Group
>sp|A6NML5|TM212_HUMAN Transmembrane protein 212 OS=Homo sapiens GN=TMEM212 PE=2 SV=2
MKGLYQAAGRILVTLGILSVCSGVIAFFPVFSYKPWFTGWSVRIACPIWNGALAITTGVLLLLAYREWTQRYLGEATFTF
VILSIMGCPLHFAIALESALLGPYCFYSFSGIAGTNYLGYAVTFPYPYAKFPLACVDPPHYEEYHLTLQALDLCLSFTLL
CTSLTVFIKLSARLIQNGHINMQLPAGNPNPFSP