TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7HIX1|A7HIX1_ANADF Putative uncharacterized protein OS=Anaeromyxobacter sp. (strain Fw109-5) GN=Anae109_4489 PE=4 SV=1
MTYLGAPAIRACPSPRGRARNARRFPVSKGRRGGFLAGPGDRESSEDKGLSSLAQGYRKAAPYMGASTTLVAAVGVFTAV
GIWVDRKVGTEVPWFTILGAVLGMAGGFISFFKQVLGSSRKRNGS