TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7I9Y9|A7I9Y9_METB6 Uncharacterized protein OS=Methanoregula boonei (strain 6A8) GN=Mboo_2036 PE=4 SV=1
MDYLYLALKFIIGGSVIVGVTVLAEHLDPKYGGLLAAAPIITTLAILFTSTGAGQEVGRQLAIGAFWFAIPTLLFLLALY
FLMGRYPLAPSFGGAFSVWLVAAVVMNRALTLA