TCDB is operated by the Saier Lab Bioinformatics Group
>A7NRF9|A7NRF9_9CHLR ThiW protein - Roseiflexus castenholzii DSM 13941.
MAATTSIVRSQTRRLAYAIVLTALAVALSPISIPVGIAKVFPVQHMVNVLAGALIGPWWGLAVALVTSIVRNALGLGTPL
AFPGSIFGVLLAGLIYRATRNIPLTVAGEVIGTGIIGALIGALVVAPYVMNRPMGATALIIPFALSSLVGAVLGALGLLA
LRRTGYLERPDTRQ