TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7RF41|A7RF41_NEMVE Predicted protein OS=Nematostella vectensis GN=v1g196263 PE=4 SV=1
MKLSLLVLLGLCWAVEAAPRTSHSSKGQQIHHDQGSERNFALPLNDDTKKDGLLGDILGNADLKSAAVDKGIEVAGKLID
KQIDTWMNQTEKASNFLKKKIKLDIMPDKGFQTEDMFAPAGYHISSELDGGDEKEKGDYEPAPIPYPGGFIGNAILNGCF
GTNYSQGDPCYSPAETKTQCRVPDTMNVHGIYDTSASMFTFSSRSEYQSFLQREAGVSGSYFGFYAGVTKAWGSSTSTNK
QMFLSVFDIGVSRYEIFKDEVKPQDLSQAFLKEFINLPPSYYTPRAPIAYQDFIMRWGTHYIKSATFGGQLELRKLMQGS
STATKTEVAEEMEVEYKSLFWSAGAKYGSRKGTSQRSETKTSSTSLEAQGGSQEIAAILSDMYSPTFKGEFKSWLQSIPD
FPKAFKFQMGSVADLVNFRYSDLFPDDEKSDKKGCDDQQNLKYDEIKGKKYFTRNIPNTVEIERVYCVFNSRAQVEQALK
DRRQSLMRAIEQYMEEALMVCRQSLMRAIEQYMEEGPISISDFSLPRGGPGCQWNSDKDANAKPDWEGVKAGTKIAQVNF
QMEAPLRGIMKKIVDGKDTITGGGVDIPQDMSRLVKRSGDRWYTSEEGGRFHLYDGFAESGTDKISIFGLKLTYDTASGG
LTLKDEADCEASKKYFPTACDLKGKQLATLTKPDKELFDKAERAELGLQPCNVQWSNAMRLDPSSQRGKCLHFTAASAGT
VYVVFSAIPSDQSTWYYVEISPFAVGIYKAGELKQYTKIVDAVGLGSPVLFQSYAVCIKQTDNSVVIEYGKSDGENTDMY
LVMIDDSSTLDVRFYAFGNGDRKAQIADAHVISRLDTKTTRENCKGEDMRYDESGICSLKCHDACDPLYGCSDPGNSPSD
TNCHKCRYAKKAESKRRRRALMYKRQTNTGDKKTVACKPSCDSGKTPNKQQICTATKQMKVVKTPVNAAANEVNIGDVDL
LKDFTFCIWMSVDMYSFNSDNFDFPLKWGNKEWHRFCIGRESPSGKISAFDDKEQLPSQNSLIKEDDMATPATLKLNLNS
GMAFDATDINIWDRVLDDEDMNFMYESCGQRAGNVKDWFDIMELIKAKSDQPSKDVNQYKPMSTATENQPTRVSNDFEPT
PSEAYDGSGEVTKRSVEEKDGSASGFYDKYQDDDNSENALEDPPNVSFVDNTCAP