TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7V2W2|A7V2W2_BACUN Putative uncharacterized protein OS=Bacteroides uniformis ATCC 8492 GN=BACUNI_01904 PE=4 SV=1
MISFTWKYSIFQVIQIFIIICYFLQFLFCIGFGYNDVTINILQYELLLIFLWSLFSAIHESGTFNLYVLFLYMLCVFIYS
RIFLDIYGLFNWTWADKYNDFIFPINVQFQILILLTFSLLFMHLGCLMGRKYLSYRKINFEYSRYLDKISTFLFLFSVPG
TFIKYLIQFKAVLEHGYLAVYDGTIANLKYPIWTTGAISIFEFSYCLFLASKPSKKKFFIISSIFFALRIADVLKGGRSK
LFLPIIFLLWYYYSFYSEQQKQKIGKLLLISIVCIILSQVLLEFRRGDVDTGYDSDLFMMFFSQQGVSLLVFAYMIFYKS
TFVNTGLPYILYPLSLTSTFEGQSMEFVEQTNSLGHRLTYFLAPDAYLGGEGVGSSFLGEFWDLGLIGFLLMSFLAGYII
RYFEKSVRNTRVIMFLAFILVPNIVYMPRASFFPSLINILIFLFFYSLILYVPKLKIKFI