TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7XLD6|A7XLD6_PLAFA Multidrug resistance-associated protein 2 OS=Plasmodium falciparum GN=mrp2 PE=2 SV=1
MMRRRSVYNFDQGKHGYLMNHISWLNFVSFNWITQLLRCLKNDDFVLPCIEETSSIEHYSTNLNRNVRNIQLRKYNKYNK
YKNYCCSKYNDGNKSCSCSTKNHTNKFHKRKKEDHFLKSSGITYAVLKTFKYYLSLISFFHIIHTIFLIFVAVCIEKYVL
LIKGGSNVVTLPFGFKNSKVLFGFIVISVIFISQFFDALLCYYDFRLRVNMEVTVMYFLYKITLGNFNNQLINRNDIYDD
HSEEGKGQHKNQCQYDENDQNDENDQNDQNEQSDLRDIRHMHDKHVKHNDEESKDSTNSTTYIKNNNNQMSHINDLSITN
NMSDVHILSSIKNQDQNNSNNVSSMDSNTNYMSKTTCLTCTGSEFNKEEKDEKKELLEEAKKKDKEVFDISIYNIMFIDT
PFLIYFITALIELANMIIKFIMSFYMFYYKMGSAAVLNGALLIIIMYGLMFAFEFSSSLFKLKYLKYRDTRISNMHHILK
EFKLMKIFNWESIAFDYVNMFRIKEMKICKIRTYLSSLSNYVNNISVNIVEVAIFFFYIRSELKSNKTVSFSSLITPLFV
YKSLISGVSNFPNIINNLIEGAINIKRINKYINYYLFNNDMNDYFKNSLNGMKSNTCNFQNGNTNNVNGYVDDYVDGYVD
DYVDDYVNDYVDDYVNDYVDDYVNDYVDDYVNDYVDDYVDDYMDHMMEYNININSKNGCSSKSRKNNKSFSKDHFSNHEQ
GTMQSFYKFLDTHKNKTKQKSDCIKKCSNNQLSKSNNNNVVGESNNSLFQDRKGWYPKNKHFKDNIVINMKNCYFSSKNN
DDYILKNINLTLKNNSVVIILGNVGSGKTIFFYSLLGQFKLSCGSFYLKNYIYKYMPILYVPQFNWISLGTIRSMILFGN
KYDESIYYDVIVKSELFHDIISFKKKDMRYISDEHSLSKGQKARICLARALYHHYIHMKHMNLYYQKNELINEKMKKISL
KRDDNHTAQRSNDNTPNNNNTDNNNTSDNNNTSNNNNTSDNNNTSDNNNTSDNNNTSNNNNTDNNNTSNNKNSCSKNLTE
ERNISYLYLFDDLFTSLDPCISKDIFYNLFCDKEKIQHFKKNSSFILSISEIILNSFISSNCILNNMQYDVLIYKLENST
LHYEGNLVDYIKKNNIVVKEDIVQTNKQCEKKSLTNEQVKSMLSLNEDWNYMHRVKKKSITQKETTKNYDNNNDNNNDNN
NDNNNDNNNDNNNNNNNDNNNNNNNNVNVSKEILSCEIKTQDHYNNIHCSKTNFEKHNNSIYSKKENETRKIHSGDIKYH
KFMVLKQFKTIYSFKTIYSFNTEETNDDEYNKTYYRKYTKVIQNYDNHCLEGKKKSFRNYKSINSYNEILIKENMKVWED
DTYYGNDYIDEYEKIKKNVLSKLKYNYYISCDYNNSDHFDFNEELKFKGNIKLETFWWYLKKIGRPLIIVIIIFMLLSIF
TDEIKNLILFLASTILKSGDKKDEEILNQQLVYLNYFILLPSISLLTTLISFMLIAHGIVKSAIKVHTEVLLSILYAPIH
AFYSNNLGNIINKFITDVNILDNGIIKRIYKTFYTIFRFLFTLFLLIYMVKYTIVIFPFIMLIIYFFVFNKYSKGCKEAQ
RGFLASHAPLCTIYSNTIIGKDVINLYKKNNYFLTLYKQKIFDFRNYTIFKWSITIWASLYVQLIVLALTFFYIIYPHFF
FKHAKQDHEINYEKEASTIGYCITFSCSLGFVIKSLLYDYTHVEKEMCSTQRLEECSKMIKDEGYSDDNITLQNNDPTHE
DNNNNNNNNNNEQDANLFKSVPGSYDPNDKENMRKYKTEIVNNTKDMYSIINKDDMLTHSINNKNNKLKKLYTSPHIDIN
KIKYGICFERVFVSYKKKICVDRKNNKYEYVNEKSCLKNINIYALKNQKIGIVGKSGAGKSTMILSILGLIGTTRGRITI
EGQDIKTLTLDERKNMIGVLPQSSFVFFHWNIRTFIDPYKDFTDDEIVDAFKLIGINLSYDDLDKYIYKQQRQQQKKKNK
NTHNLWKKKSFIDLTNSISLSDECIRYLSLVRLFLNRHKYKLILIDEIPVLNFCYNTKKLTNFFTTDIKSFDYIIRTFFQ
NTTVLIIAHDASTLSCCDFIYVIAKGEVVYKCSYKDVKTQTELANLLQEKQLN