TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8IUR9|A8IUR9_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_172969 PE=4 SV=1
MARLNELTGGALKSACVVSLVLLLLPKSSLASLAANCTPSTLGYACMAQQGEVTVHWSANTASAPANPCTPAARMVLTGY
MGGFVAISFAKSPGTMFPGDTVLGWADATGTSSFIGTFHVTDRSLDDSNRLTGAADWAYDKGVSQASLCGVDTDGGRPEG
SITTICFSRMLLEPRAFASADLRPTVMMSTDPTTNTTTGATTAQPLGLNWAVASWDELREHYARNRGGFYLDLTAGAAAQ
AADNTWSQQRRGWVIAHGVLMTVAWVFFLPLGPLFPAHRWLLRGATAPPQWYRGGGKQLWFLGHVSCQWVGFALLVAGYG
IGHSKHVHERGRTQSSLIPPGGAAKAHNPLGNAVMIIAFVQVLLAHATRPAPDSGLRRRVWEYGHRIVGRCVIALAWAQV
LIGAHVAAGEGIGRFWQWAGPMIGGMATMVLADLSLRVVGWRQREPATSLEALSAATDVGTDKQHYVEMGKGGDNMGASE
ATPAQAGHGKGGRLGEPLVGAGGAGNGGSSTAVAEALVRSRPSMAAASVASVAEA