TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8J6W0|A8J6W0_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_192544 PE=4 SV=1
MSARRSSRLFPALLSAVQQGAAAGTQVGVAPVSLQALCAGSQRLRLPGQGMGLLGRTFASQPLATADAKDRFDSTNSLLQ
QVQVLKLRQELDDESVMNLHIPYTQLLQMIKASGSAHDDKEAEEVALALHRAGVVMRHHDVVYLRPEEIAEVVMQVLPGG
KDDASQKLAKIEEELTDLDKIHEQVDKQANNVTTRLLTVGYVVLFVQLISFIYLTWWELSWDVMEPIAYIISLFYSLLGY
TYFMATKGGVFDLQPFKEFWQTHYKQKKASAVQFDAERYEYLLKMKERYKRHLAHAALRR