TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8JBD0|A8JBD0_CHLRE OST3/OST6 family protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_196082 PE=4 SV=1
MMTVRMLLLLVVASLSLCGALAQPNVAGLSALRQQSRDRVITLTDEVLSEFIMGRSRPYSAVIYYSAQQVSEGNPSLKLD
ELRREYAYAAKAFAAGPDADKVFFFEAALEVTQKPFAMLQVNSLPYVVRIPGSQAVAQATLELPKADKMLPENTKGAYPW
PAETFVAFVSGRTGAAAAEIDRPSIYKSPFFPPVIFGGVLTAAYLGYKVYALGALRHSAIWAVLSLAVFWFSASGGMYNI
IRGMPFFIRDRNGRLQFFLTSRQGQLGAEGFMLGTLYLMVGGSLAFVTYLAPRISSSRIRDSCSLVGALIAASSMYQTFK
LWNLKTGYKHVSYF